Recombinant Streptomyces viridochromogenes Phosphinothricin N-acetyltransferase
Product Description
Link: http://www.cusabio.com/Recombinant-Protein/Recombinant-Streptomyces-viridochromogenes-Phosphinothricin-N-acetyltransferase-11106407.html
| Product Name: |
Recombinant Streptomyces viridochromogenes Phosphinothricin N-acetyltransferase
|
| Product Type : |
Recombinant Protein |
| Code : |
CSB-EP701139FOQ |
| Size : |
1mg/500ug/200ug/50ug/10ug |
| Uniprot NO. : |
Q57146 |
| Storage : |
Store at -20℃, for extended storage, conserve at -20℃ or -80℃. |
| Relevance : |
Inactivates phosphinothricin (PPT) by transfer of an acetyl group from acetyl CoA. This enzyme is an effector of phosphinothricin tripeptide (PTT or bialaphos) resistance. |
| Image : |
|
| References : |
"Cloning of a phosphinothricin N-acetyltransferase gene from Streptomyces viridochromogenes Tue494 and its expression in Streptomyces lividans and Escherichia coli." Strauch E., Wohlleben W., Puehler A. Gene 63:65-74(1988) |
| Storage Buffer : |
20mM Tris-HCl based buffer,pH8.0 |
| Alias : |
Phosphinothricin-resistance protein |
| Species : |
Streptomyces viridochromogenes |
| Purity : |
Greater than 90% as determined by SDS-PAGE. |
| Sequence : |
MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI |
| Research Area : |
Others |
| Protocol : |
Instructions
Protocol may be improved. Please feel free to contact CUSABIO product specialist to obtain the latest version.
|
| Source : |
E.coli |
| Gene Names : |
pat |
| Expression Region : |
1-183aa |
| Notes : |
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
| Product Info : |
His-SUMO-tag |
| Mol. Weight : |
36.61kD |
| Protein Description : |
Full length |
Product Image
Img 1
Send Inquiry to this Member
Related Products of this Company
This member assumes full responsibility for the content of this listing. DIYTrade accepts no responsibility whatsoever in respect of such content.
To report fraudulent or illegal content, please
click here.
China Suppliers Quick Searching:
,
